6EMUA

Crystal structure of dual specific trm10 construct from thermococcus kodakaraensis.
Warning
  • Chain breaks within knot 31 (displayed as a gray area on the plot and as '-' on the sequence). The broken part of the chain has been replaced by a straight segment, which may affect what knot types are detected - be careful with interpreting results.
Knot K +31
Knot core range Knot core length Knot tails range Slipknot tails range Slipknot loops range N-end length C-end length Type
view details
+31 83-134 52 1-82, 135-175 82 41 knot
Chain Sequence
WPYFIIDLYHWDKHTQKEKGKIALQVNQSYGLLRDYF---ELAVTWANEEFREMFHGPLDRITTYGGPTSEFLKENGINEVVLLDPWAEEVLSEKDFDVKAFIIGGIVDTNKK--KTTPKIGEELESAGIKVRRRKIVLRGDVVGVPDRINRILGIILKMMVEGKSMDEAVYEMQ
Whole chain analysis
Subchain analysis 

Knotoid cutoff: 0.5


Knotoid matrix content: 1

Knot core range Knot core length Knot tails range Slipknot tails range Slipknot loops range N-end length C-end length Type
view details
3.1 80-132 53 1-79, 133-170 79 38 knot
view details
2.1 79-128 50 1-78 133-170 129-132 78 38 slipknot
view details
2.1 82-151 70 152-170 1-79 80-81 79 18 slipknot
sequence length 175
structure length 170
publication title Structural and biochemical analysis of the dual-specificity Trm10 enzyme fromThermococcus kodakaraensisprompts reconsideration of its catalytic mechanism.
pubmed doi rcsb
molecule tags Rna binding protein
molecule keywords tRNA (guanine(9)-/adenine(9)-N1)-methyltransferase
source organism Thermococcus kodakarensis
missing residues 38-40, 111-112
total genus Genus: 57
ec nomenclature
pdb deposition date 2017-10-03
KnotProt deposition date 2018-07-22
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the KnotProt database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the KnotProt database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...

KnotProt | Interdisciplinary Laboratory of Biological Systems Modelling
Application loaded.