| Knot core range | Knot core length | Knot tails range | Slipknot tails range | Slipknot loops range | N-end length | C-end length | Type | |||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| view details |
 |
-31 | 16-63 | 48 | 1-15, 64-93 | 15 | 30 | knot |
Chain Sequence |
PDLIFCRKQAGVAIGRLCEKCDGKCVICDSYVRPCTLVRICDECNYGSYQGRCVICGGPGVSDAYYCKECTIQEKDRDGCPKIVNLGSSKTDL
|
| Knot core range | Knot core length | Knot tails range | Slipknot tails range | Slipknot loops range | N-end length | C-end length | Type | ||||
|---|---|---|---|---|---|---|---|---|---|---|---|
|
|
- 31 | 11-58 | 48 | 1-10, 59-76 | 10 | 18 | knot |
| Fingerprint | Knot forming loop | Loop type | ||||
|---|---|---|---|---|---|---|
|
|
K -31 | Cys11 ... Cys85 <-> Bridging ionZn103 <-> Cys11 |
ion-based | |||
|
|
K -31 | Cys11 ... Cys72 <-> Bridging ionZn101 <-> Cys75 ... Cys85 <-> Bridging ionZn103 <-> Cys11 |
ion-based | |||
|
|
K -31 | Cys11 ... Cys30 <-> Bridging ionZn101 <-> Cys33 ... Cys85 <-> Bridging ionZn103 <-> Cys11 |
ion-based | |||
|
|
K -31 | Cys11 <-> Bridging ionZn103 <-> Cys85 ... Cys61 <-> Bridging ionZn102 <-> Cys58 ... Cys11 |
ion-based | |||
|
|
K -31 | Pro6 ... Cys72 <-> Bridging ionZn101 <-> Cys75 ... Chain closureLeu98 <-> Pro6 |
probabilistic | |||
|
|
K -31 | Pro6 ... Cys30 <-> Bridging ionZn101 <-> Cys33 ... Chain closureLeu98 <-> Pro6 |
probabilistic | |||
|
|
K -31 | Pro6 ... Cys58 <-> Bridging ionZn102 <-> Cys61 ... Chain closureLeu98 <-> Pro6 |
probabilistic | |||
|
|
K -31 | Pro6 ... Cys46 <-> Bridging ionZn103 <-> Cys49 ... Chain closureLeu98 <-> Pro6 |
probabilistic | |||
|
|
K -31 | Cys11 <-> Bridging ionZn103 <-> Cys85 ... Cys75 <-> Bridging ionZn101 <-> Cys72 ... Cys61 <-> Bridging ionZn102 <-> Cys58 ... Cys11 |
ion-based | |||
|
|
K -31 | Cys11 <-> Bridging ionZn103 <-> Cys85 ... Cys61 <-> Bridging ionZn102 <-> Cys58 ... Cys33 <-> Bridging ionZn101 <-> Cys30 ... Cys11 |
ion-based | |||
|
|
K -31 | Pro6 ... Cys58 <-> Bridging ionZn102 <-> Cys61 ... Cys72 <-> Bridging ionZn101 <-> Cys75 ... Chain closureLeu98 <-> Pro6 |
probabilistic | |||
|
|
K -31 | Pro6 ... Cys30 <-> Bridging ionZn101 <-> Cys33 ... Cys58 <-> Bridging ionZn102 <-> Cys61 ... Chain closureLeu98 <-> Pro6 |
probabilistic | |||
|
|
K -31 | Pro6 ... Cys46 <-> Bridging ionZn103 <-> Cys49 ... Cys72 <-> Bridging ionZn101 <-> Cys75 ... Chain closureLeu98 <-> Pro6 |
probabilistic | |||
|
|
K -31 | Pro6 ... Cys30 <-> Bridging ionZn101 <-> Cys33 ... Cys46 <-> Bridging ionZn103 <-> Cys49 ... Chain closureLeu98 <-> Pro6 |
probabilistic | |||
|
|
K -31 | Pro6 ... Cys46 <-> Bridging ionZn103 <-> Cys49 ... Cys58 <-> Bridging ionZn102 <-> Cys61 ... Chain closureLeu98 <-> Pro6 |
probabilistic | |||
|
|
K -31 | Pro6 ... Cys46 <-> Bridging ionZn103 <-> Cys49 ... Cys58 <-> Bridging ionZn102 <-> Cys61 ... Cys72 <-> Bridging ionZn101 <-> Cys75 ... Chain closureLeu98 <-> Pro6 |
probabilistic | |||
|
|
K -31 | Pro6 ... Cys30 <-> Bridging ionZn101 <-> Cys33 ... Cys46 <-> Bridging ionZn103 <-> Cys49 ... Cys58 <-> Bridging ionZn102 <-> Cys61 ... Chain closureLeu98 <-> Pro6 |
probabilistic |
Chain Sequence |
PDLIFCRKQAGVAIGRLCEKCDGKCVICDSYVRPCTLVRICDECNYGSYQGRCVICGGPGVSDAYYCKECTIQEKDRDGCPKIVNLGSSKTDL
|
Knotoid cutoff: 0.5
Knotoid matrix content: 1
| Knot core range | Knot core length | Knot tails range | Slipknot tails range | Slipknot loops range | N-end length | C-end length | Type | |||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| view details |
 |
3.1m | 15-87 | 73 | 1-14, 88-93 | 14 | 6 | knot | ||||
| view details |
|
3.1m | 14-65 | 52 | 1-13 | 88-93 | 66-87 | 13 | 6 | slipknot |
| sequence length |
93
|
| structure length |
93
|
| publication title |
Structural Basis of Splicing Modulation by Antitumor Macrolide Compounds.
pubmed doi rcsb |
| molecule tags |
Splicing
|
| molecule keywords |
Splicing factor 3B subunit 3
|
| source organism |
Homo sapiens
|
| total genus |
 Genus: 16
|
| ec nomenclature | |
| pdb deposition date | 2017-10-04 |
| KnotProt deposition date | 2018-10-17 |
Image from the rcsb pdb (www.rcsb.org)
#similar chains in the KnotProt database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unknotted ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...
