| Loop | Piercing | ||||
|---|---|---|---|---|---|
| view details | 37-c-55-b-106-c-91 | 23-b-81 |
Chain Sequence |
MWPKRLTKAHWFEIQHIQPSPLQCNRAMSGINNYTQHCKHQNTFLHDSFQNVAAVCDLLSIVCKNRRHNCHQSSKPVNMTDCRLTSGKYPQCRYSAAAQYKFFIVACDPPQKSDPPYKLVPVHLDSIL
|
| sequence length |
128
|
| structure length |
128
|
| publication title |
Characterization of an RNase with two catalytic centers. Human RNase6 catalytic and phosphate-binding site arrangement favors the endonuclease cleavage of polymeric substrates.
pubmed doi rcsb |
| molecule tags |
Hydrolase
|
| molecule keywords |
Ribonuclease K6
|
| source organism |
Homo sapiens
|
| ec nomenclature | |
| pdb deposition date | 2017-10-05 |
Image from the rcsb pdb (www.rcsb.org)
#similar chains in the KnotProt database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unknotted ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...
