| Knot core range | Knot core length | Knot tails range | Slipknot tails range | Slipknot loops range | N-end length | C-end length | Type | |||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| view details |
 |
+31 | 23-255 | 233 | 1-22, 256-257 | 22 | 1 | slipknot |
Chain Sequence |
DWGYDDKNGPEQWSKLYPIANGNNQSPVDIKTSETKHDTSLKPISVSYNPATAKEIINVGHSFHVNFEDNDNRSVLKGGPFSDSYRLFQFHFHWGSTNEHGSEHTVDGVKYSAELHVAHWNSAKYSSLAEAASKADGLAVIGVLMKVGEANPKLQKVLDALQAIKTKGKRAPFTNFDPSTLLPSSLDFWTYPGSLTHPPLYESVTWIICKESISVSSEQLAQFRSLLSNVEGDNAVPMQHNNRPTQPLKGRTVRASF
|
| Knot core range | Knot core length | Knot tails range | Slipknot tails range | Slipknot loops range | N-end length | C-end length | Type | ||||
|---|---|---|---|---|---|---|---|---|---|---|---|
|
|
+ 31 | 21-255 | 235 | 256-257 | 1-1 | 2-20 | 1 | 1 | slipknot |
| Fingerprint | Knot forming loop | Loop type | ||||
|---|---|---|---|---|---|---|
|
|
K +31 | Asp4 ... His94 <-> Bridging ionZn301 <-> His96 ... Chain closurePhe260 <-> Asp4 |
probabilistic | |||
|
|
K +31 | Asp4 ... His96 <-> Bridging ionZn301 <-> His119 ... Chain closurePhe260 <-> Asp4 |
probabilistic | |||
|
|
K +31 | Asp4 ... His94 <-> Bridging ionZn301 <-> His119 ... Chain closurePhe260 <-> Asp4 |
probabilistic |
Chain Sequence |
DWGYDDKNGPEQWSKLYPIANGNNQSPVDIKTSETKHDTSLKPISVSYNPATAKEIINVGHSFHVNFEDNDNRSVLKGGPFSDSYRLFQFHFHWGSTNEHGSEHTVDGVKYSAELHVAHWNSAKYSSLAEAASKADGLAVIGVLMKVGEANPKLQKVLDALQAIKTKGKRAPFTNFDPSTLLPSSLDFWTYPGSLTHPPLYESVTWIICKESISVSSEQLAQFRSLLSNVEGDNAVPMQHNNRPTQPLKGRTVRASF
|
Knotoid cutoff: 0.5
Knotoid matrix content: 1
| Knot core range | Knot core length | Knot tails range | Slipknot tails range | Slipknot loops range | N-end length | C-end length | Type | |||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| view details |
 |
2.1 | 25-252 | 228 | 1-24, 253-257 | 24 | 5 | knot |
| sequence length |
257
|
| structure length |
257
|
| publication title |
2-Benzylpiperazine: A new scaffold for potent human carbonic anhydrase inhibitors. Synthesis, enzyme inhibition, enantioselectivity, computational and crystallographic studies and in vivo activity for a new class of intraocular pressure lowering agents.
pubmed doi rcsb |
| molecule tags |
Lyase
|
| molecule keywords |
Carbonic anhydrase 1
|
| total genus |
 Genus: 76
|
| ec nomenclature | |
| pdb deposition date | 2017-11-07 |
| KnotProt deposition date | 2018-10-12 |
Image from the rcsb pdb (www.rcsb.org)
#similar chains in the KnotProt database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unknotted ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...
