Knot core range | Knot core length | Knot tails range | Slipknot tails range | Slipknot loops range | N-end length | C-end length | Type | |||||
---|---|---|---|---|---|---|---|---|---|---|---|---|
view details |
![]() |
+31 | 26-254 | 229 | 1-25, 255-257 | 25 | 3 | knot |
Chain Sequence |
DWGYDDKNGPEQWSKLYPIANGNNQSPVDIKTSETKHDTSLKPISVSYNPATAKEIINVGHSFHVNFEDNDNRSVLKGGPFSDSYRLFQFHFHWGSTNEHGSEHTVDGVKYSAELHVAHWNSAKYSSLAEAASKADGLAVIGVLMKVGEANPKLQKVLDALQAIKTKGKRAPFTNFDPSTLLPSSLDFWTYPGSLTHPPLYESVTWIICKESISVSSEQLAQFRSLLSNVEGDNAVPMQHNNRPTQPLKGRTVRASF
|
Knot core range | Knot core length | Knot tails range | Slipknot tails range | Slipknot loops range | N-end length | C-end length | Type | ||||
---|---|---|---|---|---|---|---|---|---|---|---|
![]() |
+ 31 | 23-254 | 232 | 255-257 | 1-1 | 2-22 | 1 | 2 | slipknot |
Fingerprint | Knot forming loop | Loop type | ||||
---|---|---|---|---|---|---|
|
K +31 | Asp4 ... His94 <-> Bridging ionZn301 <-> His96 ... Chain closurePhe260 <-> Asp4 |
probabilistic | |||
|
K +31 | Asp4 ... His96 <-> Bridging ionZn301 <-> His119 ... Chain closurePhe260 <-> Asp4 |
probabilistic | |||
|
K +31 | Asp4 ... His94 <-> Bridging ionZn301 <-> His119 ... Chain closurePhe260 <-> Asp4 |
probabilistic |
Chain Sequence |
DWGYDDKNGPEQWSKLYPIANGNNQSPVDIKTSETKHDTSLKPISVSYNPATAKEIINVGHSFHVNFEDNDNRSVLKGGPFSDSYRLFQFHFHWGSTNEHGSEHTVDGVKYSAELHVAHWNSAKYSSLAEAASKADGLAVIGVLMKVGEANPKLQKVLDALQAIKTKGKRAPFTNFDPSTLLPSSLDFWTYPGSLTHPPLYESVTWIICKESISVSSEQLAQFRSLLSNVEGDNAVPMQHNNRPTQPLKGRTVRASF
|
Knotoid cutoff: 0.5
Knotoid matrix content: 1
Knot core range | Knot core length | Knot tails range | Slipknot tails range | Slipknot loops range | N-end length | C-end length | Type | |||||
---|---|---|---|---|---|---|---|---|---|---|---|---|
view details |
![]() |
2.1 | 24-252 | 229 | 1-23, 253-257 | 23 | 5 | knot |
sequence length |
257
|
structure length |
257
|
publication title |
New classes of carbonic anhydrase inhibitors
rcsb |
molecule tags |
Lyase
|
molecule keywords |
Carbonic anhydrase 1
|
total genus |
![]() |
ec nomenclature | |
pdb deposition date | 2017-12-15 |
KnotProt deposition date | 2018-10-12 |
#similar chains in the KnotProt database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unknotted ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...