| Loop | Piercing | ||||
|---|---|---|---|---|---|
| view details | 208-c-227-b-230-c-230 | 205-b-230 |
Chain Sequence |
SLAKNYEIVVVTGTNGKTLTTALTVGILKEVYGQVLTNPSGANMITGIATTK----------NIAVLEIDEASLSRICDYIQPSLFVITNIFRDQGEIYTTYNMIL----DAIRKVPTATVLLNGDSPLFYKPTIPNPIEYFGFDLEKGPAQLAHYNTEGILCPDCQGILKYEHNTYANLGAYICEGCGCKRPDLDYRLTKLVELTNNRSRFVIDGQEYGIQIGGLYNIYNALAAVAIARFLGADSQLIKQGFDKSRAVFGRQETFHIGDKECTLVLIKNPVGATQAIEMIKLAPYPFSLSVLLNANYADGIDTSWIWDADFEQITDMDIPEINAGGVRHSEIARRLRVTGYPAEKITETSNLEQVLKTIENQDCKHAYILATYTAMLEFRELLASR
|
| sequence length |
397
|
| structure length |
383
|
| publication title |
Structure of the essential peptidoglycan amidotransferase MurT/GatD complex from Streptococcus pneumoniae.
pubmed doi rcsb |
| molecule tags |
Ligase
|
| molecule keywords |
Mur ligase family protein
|
| source organism |
Streptococcus pneumoniae
|
| missing residues |
52-61, 96-99
|
| ec nomenclature | |
| pdb deposition date | 2018-02-13 |
Image from the rcsb pdb (www.rcsb.org)
#similar chains in the KnotProt database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unknotted ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...
