6GAWBw

Unique features of mammalian mitochondrial translation initiation revealed by cryo-em. this file contains the complete 55s ribosome.
Knot K -31 -31 -31 -31
Knot core range Knot core length Knot tails range Slipknot tails range Slipknot loops range N-end length C-end length Type
view details
-31 187-251 65 1-186, 252-387 186 136 knot
Chain Sequence
PVARYPPIVASLTAKSKAARQRRVEQWQATVHAAKSVDEKLRILTKMQFMKYVVYPQTFALNADNWYQSFTKTVFLSGLPPTPAKLEPEPTLDITALREAVCDCLLQEHFFLRRKKRAPVIQDREAIASPFLDQLVASLTGLLSVHNPVLAAAALDCKRPVHFFWLRGEEIIPRGHRKGRVDALRYQINDKPHNQIRISRQLPEFVPLDYSIPIEVPVMSCKPDKLPLFKRQYENTIFIGSKTADPLCYGHTQFHLLPDKLKREKLLKQNCADQIEVVFRANAIASLFAWTGAQAMYQGFWSEADVTRPFVSQGVITDGKYFSFFCYQLNTLALTAQADQNNPRKNICWGTQSKPLYETIEDNNVKGFNDDVLLQLVQFLLNRPKED
Whole chain analysis
Subchain analysis 

Knotoid cutoff: 0.5


Knotoid matrix content: 1

Knot core range Knot core length Knot tails range Slipknot tails range Slipknot loops range N-end length C-end length Type
view details
2.1m 53-373 321 1-52 386-387 374-385 52 2 slipknot
view details
3.1m 186-253 68 1-165, 283-387 166-185, 254-282 165 105 slipknot
view details
2.1m 186-282 97 1-165, 294-387 166-185, 283-293 165 94 slipknot
view details
3.1m 186-313 128 1-165, 327-387 166-185, 314-326 165 61 slipknot
view details
3.1m 186-348 163 349-387 1-167 168-185 167 38 slipknot
sequence length 387
structure length 387
publication title Unique features of mammalian mitochondrial translation initiation revealed by cryo-EM.
pubmed doi rcsb
molecule tags Ribosome
molecule keywords Mitochondrial ribosomal protein L12
source organism Homo sapiens
total genus Genus: 38
ec nomenclature
pdb deposition date 2018-04-13
KnotProt deposition date 2018-09-14
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the KnotProt database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the KnotProt database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...

KnotProt | Interdisciplinary Laboratory of Biological Systems Modelling
Application loaded.