6GB2Bw

Unique features of mammalian mitochondrial translation initiation revealed by cryo-em. this file contains the 39s ribosomal subunit.
Knot K -31 -31 -31 -31
Knot core range Knot core length Knot tails range Slipknot tails range Slipknot loops range N-end length C-end length Type
view details
-31 187-250 64 1-186, 251-387 186 137 knot
Chain Sequence
PVARYPPIVASLTAKSKAARQRRVEQWQATVHAAKSVDEKLRILTKMQFMKYVVYPQTFALNADNWYQSFTKTVFLSGLPPTPAKLEPEPTLDITALREAVCDCLLQEHFFLRRKKRAPVIQDREAIASPFLDQLVASLTGLLSVHNPVLAAAALDCKRPVHFFWLRGEEIIPRGHRKGRVDALRYQINDKPHNQIRISRQLPEFVPLDYSIPIEVPVMSCKPDKLPLFKRQYENTIFIGSKTADPLCYGHTQFHLLPDKLKREKLLKQNCADQIEVVFRANAIASLFAWTGAQAMYQGFWSEADVTRPFVSQGVITDGKYFSFFCYQLNTLALTAQADQNNPRKNICWGTQSKPLYETIEDNNVKGFNDDVLLQLVQFLLNRPKED
Whole chain analysis
Subchain analysis 

Knotoid cutoff: 0.5


Knotoid matrix content: 1

Knot core range Knot core length Knot tails range Slipknot tails range Slipknot loops range N-end length C-end length Type
view details
3.1m 185-253 69 1-165, 283-387 166-184, 254-282 165 105 slipknot
view details
3.1m 185-313 129 1-165, 327-387 166-184, 314-326 165 61 slipknot
view details
2.1m 185-282 98 1-166, 293-387 167-184, 283-292 166 95 slipknot
view details
2.1m 178-292 115 1-168, 294-387 169-177, 293-293 168 94 slipknot
view details
3.1m 186-348 163 349-387 1-167 168-185 167 38 slipknot
sequence length 387
structure length 387
publication title Unique features of mammalian mitochondrial translation initiation revealed by cryo-EM.
pubmed doi rcsb
molecule tags Ribosome
molecule keywords Mitochondrial ribosomal protein L12
source organism Homo sapiens
total genus Genus: 39
ec nomenclature
pdb deposition date 2018-04-13
KnotProt deposition date 2018-09-13
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the KnotProt database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the KnotProt database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...

KnotProt | Interdisciplinary Laboratory of Biological Systems Modelling