| Loop | Piercing | ||||
|---|---|---|---|---|---|
| view details | 322-c-326-b-389-c-387 | 293-b-356 |
Chain Sequence |
ALDTNYCFSSTEKNCCVRQLYIDFRKDLGWKWIHEPKGYHANFCLGPCPYIWSLDTQYSKVLALYNQHNPGASAAPCCVPQALEPLPIVYYVGRKPKVEQLSNMIVRSCKCS
|
| sequence length |
112
|
| structure length |
112
|
| publication title |
Structural basis of latent TGF-beta 1 presentation and activation by GARP on human regulatory T cells.
pubmed doi rcsb |
| molecule tags |
Immune system
|
| molecule keywords |
Transforming growth factor beta-1
|
| source organism |
Homo sapiens
|
| ec nomenclature | |
| pdb deposition date | 2018-04-30 |
Image from the rcsb pdb (www.rcsb.org)
#similar chains in the KnotProt database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unknotted ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...
