6GFTA

Antinociceptive evaluation of cyriotoxin-1a, the first toxin purified from cyriopagopus schioedtei spider venom
Cysteine knot
Loop Piercing
view details
2-c-9-b-22-c-17 16-b-29
Chain Sequence
ECKGFGKSCVPGKNECCSGLTCSNKHKWCKVLL
sequence length 33
structure length 33
publication title From identification to functional characterization of cyriotoxin-1a, an antinociceptive toxin from Cyriopagopus schioedtei spider.
pubmed doi rcsb
molecule tags Toxin
molecule keywords cyriotoxin-1a
ec nomenclature
pdb deposition date 2018-05-02
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the KnotProt database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the KnotProt database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...

KnotProt | Interdisciplinary Laboratory of Biological Systems Modelling
Application loaded.