| Loop | Piercing | ||||
|---|---|---|---|---|---|
| view details | 130-c-134-b-196-c-194 | 103-b-165 |
Chain Sequence |
LGARPCGLRELEVRVSELGLGYASDETVLFRYCAGACEAAARVYDLGLRRLRQRRRLRRERVRAQPCCRPTAYEDEVSFLDAHSRYHTVHELSARECACV
|
| sequence length |
100
|
| structure length |
100
|
| publication title |
Cryo-EM structure of the activated RET signaling complex reveals the importance of its cysteine-rich domain.
pubmed doi rcsb |
| molecule tags |
Signaling protein
|
| molecule keywords |
Neurturin
|
| source organism |
Homo sapiens
|
| ec nomenclature | |
| pdb deposition date | 2018-05-23 |
Image from the rcsb pdb (www.rcsb.org)
#similar chains in the KnotProt database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unknotted ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...
