6H38A

The crystal structure of human carbonic anhydrase vii in complex with 4-[(4-fluorophenyl)methyl]-1-piperazinyl]benzenesulfonamide.
Slipknot S +31
Knot core range Knot core length Knot tails range Slipknot tails range Slipknot loops range N-end length C-end length Type
view details
+31 22-254 233 1-21, 255-259 21 5 knot
Chain Sequence
GWGYGQDDGPSHWHKLYPIAQGDRQSPINIISSQAVYSPSLQPLELSYEACMSLSITNNGHSVQVDFNDSDDRTVVTGGPLEGPYRLKQFHFHWGKKHDVGSEHTVDGKSFPSELHLVHWNAKKYSTFGEAASAPDGLAVVGVFLETGDEHPSMNRLTDALYMVRFKGTKAQFSCFNPKSLLPASRHYWTYPGSLTTPPLSESVTWIVLREPISISERQMGKFRSLLFTSEDDERIHMVNNFRPPQPLKGRVVKASFRA
Note, that the numbers in the matrix denote the consecutive residues in the loop, not the index of amino acids in the chain!
Knot K 4x +31
Knot core range Knot core length Knot tails range Slipknot tails range Slipknot loops range N-end length C-end length Type
+ 31 23-253 231 1-22, 254-259 22 5 slipknot
Fingerprint Knot forming loop Loop type
K +31 Gly4 ... His94 <->
Bridging ionZn301
<-> His96 ...
Chain closureAla262 <-> Gly4
probabilistic
K +31 Gly4 ... Cys54 <-> Cys178 ...
Chain closureAla262 <-> Gly4
probabilistic
K +31 Gly4 ... His96 <->
Bridging ionZn301
<-> His119 ...
Chain closureAla262 <-> Gly4
probabilistic
K +31 Gly4 ... His94 <->
Bridging ionZn301
<-> His119 ...
Chain closureAla262 <-> Gly4
probabilistic
Chain Sequence
GWGYGQDDGPSHWHKLYPIAQGDRQSPINIISSQAVYSPSLQPLELSYEACMSLSITNNGHSVQVDFNDSDDRTVVTGGPLEGPYRLKQFHFHWGKKHDVGSEHTVDGKSFPSELHLVHWNAKKYSTFGEAASAPDGLAVVGVFLETGDEHPSMNRLTDALYMVRFKGTKAQFSCFNPKSLLPASRHYWTYPGSLTTPPLSESVTWIVLREPISISERQMGKFRSLLFTSEDDERIHMVNNFRPPQPLKGRVVKASFRA
Whole chain analysis
Subchain analysis 

Knotoid cutoff: 0.5


Knotoid matrix content: 1

Knot core range Knot core length Knot tails range Slipknot tails range Slipknot loops range N-end length C-end length Type
view details
3.1 26-255 230 1-25, 256-259 25 4 knot
view details
2.1 22-252 231 1-21 258-259 253-257 21 2 slipknot
sequence length 259
structure length 259
publication title Exploring structural properties of potent human carbonic anhydrase inhibitors bearing a 4-(cycloalkylamino-1-carbonyl)benzenesulfonamide moiety.
pubmed doi rcsb
molecule tags Lyase
molecule keywords Carbonic anhydrase 7
source organism Homo sapiens
total genus Genus: 78
ec nomenclature
pdb deposition date 2018-07-17
KnotProt deposition date 2019-01-08
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the KnotProt database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the KnotProt database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...

KnotProt | Interdisciplinary Laboratory of Biological Systems Modelling