| Knot core range | Knot core length | Knot tails range | Slipknot tails range | Slipknot loops range | N-end length | C-end length | Type | |||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| view details |
|
+31 | 22-253 | 232 | 1-21, 254-256 | 21 | 3 | knot |
Chain Sequence |
WGYDDKNGPEQWSKLYPIANGNNQSPVDIKTSETKHDTSLKPISVSYNPATAKEIINVGHSFHVNFEDNDNRSVLKGGPFSDSYRLFQFHFHWGSTNEHGSEHTVDGVKYSAELHVAHWNSAKYSSLAEAASKADGLAVIGVLMKVGEANPKLQKVLDALQAIKTKGKRAPFTNFDPSTLLPSSLDFWTYPGSLTHPPLYESVTWIICKESISVSSEQLAQFRSLLSNVEGDNAVPMQHNNRPTQPLKGRTVRASF
|
| Knot core range | Knot core length | Knot tails range | Slipknot tails range | Slipknot loops range | N-end length | C-end length | Type | ||||
|---|---|---|---|---|---|---|---|---|---|---|---|
|
|
+ 31 | 22-253 | 232 | 1-21, 254-256 | 21 | 3 | knot |
| Fingerprint | Knot forming loop | Loop type | ||||
|---|---|---|---|---|---|---|
|
|
K +31 | Chain closureTrp6 <-> Phe261 ... His97 <-> Bridging ionZn301 <-> His95 ... Trp6 |
probabilistic | |||
|
|
K +31 | Trp6 ... His97 <-> Bridging ionZn301 <-> His120 ... Chain closurePhe261 <-> Trp6 |
probabilistic | |||
|
|
K +31 | Chain closureTrp6 <-> Phe261 ... His120 <-> Bridging ionZn301 <-> His95 ... Trp6 |
probabilistic |
Chain Sequence |
WGYDDKNGPEQWSKLYPIANGNNQSPVDIKTSETKHDTSLKPISVSYNPATAKEIINVGHSFHVNFEDNDNRSVLKGGPFSDSYRLFQFHFHWGSTNEHGSEHTVDGVKYSAELHVAHWNSAKYSSLAEAASKADGLAVIGVLMKVGEANPKLQKVLDALQAIKTKGKRAPFTNFDPSTLLPSSLDFWTYPGSLTHPPLYESVTWIICKESISVSSEQLAQFRSLLSNVEGDNAVPMQHNNRPTQPLKGRTVRASF
|
Knotoid cutoff: 0.5


Knotoid matrix content: 1
| Knot core range | Knot core length | Knot tails range | Slipknot tails range | Slipknot loops range | N-end length | C-end length | Type | |||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| view details |
|
2.1 | 21-251 | 231 | 1-20, 252-256 | 20 | 5 | knot | ||||
| view details |
|
3.1 | 23-254 | 232 | 255-256 | 1-20 | 21-22 | 20 | 1 | slipknot |
| sequence length |
256
|
| structure length |
256
|
| publication title |
Selenols: a new class of carbonic anhydrase inhibitors.
pubmed doi rcsb |
| molecule tags |
Lyase
|
| molecule keywords |
Carbonic anhydrase 1
|
| source organism |
Homo sapiens
|
| total genus |
Genus: 70
|
| ec nomenclature | |
| pdb deposition date | 2018-10-15 |
| KnotProt deposition date | 2019-01-09 |
Image from the rcsb pdb (www.rcsb.org)
#similar chains in the KnotProt database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unknotted ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...