| Knot core range | Knot core length | Knot tails range | Slipknot tails range | Slipknot loops range | N-end length | C-end length | Type | |||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| view details |
 |
+31 | 26-254 | 229 | 1-25, 255-257 | 25 | 3 | knot |
Chain Sequence |
DWGYDDKNGPEQWSKLYPIANGNNQSPVDIKTSETKHDTSLKPISVSYNPATAKEIINVGHSFHVNFEDNDNRSVLKGGPFSDSYRLFQFHFHWGSTNEHGSEHTVDGVKYSAELHVAHWNSAKYSSLAEAASKADGLAVIGVLMKVGEANPKLQKVLDALQAIKTKGKRAPFTNFDPSTLLPSSLDFWTYPGSLTHPPLYESVTWIICKESISVSSEQLAQFRSLLSNVEGDNAVPMQHNNRPTQPLKGRTVRASF
|
| Knot core range | Knot core length | Knot tails range | Slipknot tails range | Slipknot loops range | N-end length | C-end length | Type | ||||
|---|---|---|---|---|---|---|---|---|---|---|---|
|
|
+ 31 | 22-254 | 233 | 1-21, 255-257 | 21 | 3 | knot |
| Fingerprint | Knot forming loop | Loop type | ||||
|---|---|---|---|---|---|---|
|
|
K +31 | Asp4 ... His94 <-> Bridging ionZn301 <-> His96 ... Chain closurePhe260 <-> Asp4 |
probabilistic | |||
|
|
K +31 | Asp4 ... His96 <-> Bridging ionZn301 <-> His119 ... Chain closurePhe260 <-> Asp4 |
probabilistic | |||
|
|
K +31 | Asp4 ... His94 <-> Bridging ionZn301 <-> His119 ... Chain closurePhe260 <-> Asp4 |
probabilistic |
Chain Sequence |
DWGYDDKNGPEQWSKLYPIANGNNQSPVDIKTSETKHDTSLKPISVSYNPATAKEIINVGHSFHVNFEDNDNRSVLKGGPFSDSYRLFQFHFHWGSTNEHGSEHTVDGVKYSAELHVAHWNSAKYSSLAEAASKADGLAVIGVLMKVGEANPKLQKVLDALQAIKTKGKRAPFTNFDPSTLLPSSLDFWTYPGSLTHPPLYESVTWIICKESISVSSEQLAQFRSLLSNVEGDNAVPMQHNNRPTQPLKGRTVRASF
|
Knotoid cutoff: 0.5
Knotoid matrix content: 1
| Knot core range | Knot core length | Knot tails range | Slipknot tails range | Slipknot loops range | N-end length | C-end length | Type | |||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| view details |
 |
2.1 | 24-252 | 229 | 1-23, 253-257 | 23 | 5 | knot |
| sequence length |
257
|
| structure length |
257
|
| publication title |
New classes of carbonic anhydrase inhibitors
rcsb |
| molecule tags |
Lyase
|
| molecule keywords |
Carbonic anhydrase 1
|
| total genus |
 Genus: 77
|
| ec nomenclature |
ec
4.2.1.1: Alcohol dehydrogenase. |
| pdb deposition date | 2018-10-26 |
| KnotProt deposition date | 2019-11-27 |
| chain | Pfam Accession Code | Pfam Family Identifier | Pfam Description |
|---|---|---|---|
| A | PF00194 | Carb_anhydrase | Eukaryotic-type carbonic anhydrase |
Image from the rcsb pdb (www.rcsb.org)
#similar chains in the KnotProt database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unknotted ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...
