| Loop | Piercing | ||||
|---|---|---|---|---|---|
| view details | 22-c-26-b-39-c-37 | 33-b-50 |
Chain Sequence |
GADNFDVVSCNKNCTSGQNECPEGCFCGLLGQNKKGHCYKIIGNLSGEPPVVRR
|
| sequence length |
54
|
| structure length |
54
|
| publication title |
A knottin scaffold directs the CXC-chemokine-binding specificity of tick evasins.
pubmed doi rcsb |
| molecule tags |
Peptide binding protein
|
| molecule keywords |
Evasin-3
|
| source organism |
Rhipicephalus sanguineus
|
| ec nomenclature | |
| pdb deposition date | 2018-11-02 |
Image from the rcsb pdb (www.rcsb.org)
#similar chains in the KnotProt database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unknotted ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...
