6I9JA

Human transforming growth factor beta2 in a tetragonal crystal form
Cysteine knot
Loop Piercing
view details
346-c-350-b-413-c-411 317-b-380
Chain Sequence
ALDAAYCFRNVQDNCCLRPLYIDFKRDLGWKWIHEPKGYNANFCAGACPYLWSSDTQHSRVLSLYNTINPEASASPCCVSQDLEPLTILYYIGKTPKIEQLSNMIVKSCKCS
sequence length 112
structure length 112
publication title Recombinant production, purification, crystallization, and structure analysis of human transforming growth factor beta 2 in a new conformation.
pubmed doi rcsb
molecule tags Cytokine
molecule keywords Transforming growth factor beta-2 proprotein
source organism Homo sapiens
ec nomenclature
pdb deposition date 2018-11-23
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the KnotProt database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the KnotProt database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...

KnotProt | Interdisciplinary Laboratory of Biological Systems Modelling
Application loaded.