6KI1A

The transmembrane domain of a cyanobacterium bicarbonate transporter bica
Warning
  • Chain breaks within knot 31 (displayed as a gray area on the plot and as '-' on the sequence). The broken part of the chain has been replaced by a straight segment, which may affect what knot types are detected - be careful with interpreting results.
Genus: 131
Slipknot S +31 +31 +31 +31

  Help Knotting data interpretation Full screen
Knot core range Knot core length Knot tails range Slipknot tails range Slipknot loops range N-end length C-end length Type
view details
+31 95-262 168 263-392 1-32 33-94 32 129 slipknot
Chain Sequence
QITNKIHFRNLQGDLFGGVTAAVIALPMALAFGIASGAGATAGLWGAVIVGFFAALFGGTPTLISEPTGPMTVVQTAVIASLVAADPDNGLAMAFTVVMMAGLFQIAFGLLKLGKYVTMMPYTVISGFMSGIGIILVILQLAPFLGQASPKGGVIGTLQALPNLVSNVRPVETLLALMTVGIIWFMPS---KFAPPQLVALVLGTIISITLFGDLDIRRIGEIQAGLPALQLPVFQADQLQRMLIDAAVLGMLGCIDALLTSVVADSLTRTEHNSNKELVGQGIGNVMSGLFGGLGGAGATMGTVVNIQSGGRTALSGLIRAMVLLVVILGAAKLAATIPLAVLAGIAFKVGVDIIDWGFLKVSI----KGALIMYAVIVLTVLVDLIAAVG
Note, that the numbers in the matrix denote the consecutive residues in the loop, not the index of amino acids in the chain!
Knot K 1x +31 +31 +31

  Help Knotting data interpretation Full screen
Knot core range Knot core length Knot tails range Slipknot tails range Slipknot loops range N-end length C-end length Type
+ 31 96-265 170 266-356 1-31 32-95 31 90 slipknot
Fingerprint Knot forming loop Loop type
K +31
Chain closureGln2 <-> Gly393
... Gly300 <->
Bridging ionNa402
<-> Thr262 ... Gln2		 probabilistic
Chain Sequence
QITNKIHFRNLQGDLFGGVTAAVIALPMALAFGIASGAGATAGLWGAVIVGFFAALFGGTPTLISEPTGPMTVVQTAVIASLVAADPDNGLAMAFTVVMMAGLFQIAFGLLKLGKYVTMMPYTVISGFMSGIGIILVILQLAPFLGQASPKGGVIGTLQALPNLVSNVRPVETLLALMTVGIIWFMPS---KFAPPQLVALVLGTIISITLFGDLDIRRIGEIQAGLPALQLPVFQADQLQRMLIDAAVLGMLGCIDALLTSVVADSLTRTEHNSNKELVGQGIGNVMSGLFGGLGGAGATMGTVVNIQSGGRTALSGLIRAMVLLVVILGAAKLAATIPLAVLAGIAFKVGVDIIDWGFLKVSI----KGALIMYAVIVLTVLVDLIAAVG
Whole chain analysis

  Help Knotoid data interpretation Full screen
Subchain analysis 

Knotoid cutoff: 0.5


Knotoid matrix content: 1


  Help Knotoid subchains data interpretation Full screen
Knot core range Knot core length Knot tails range Slipknot tails range Slipknot loops range N-end length C-end length Type
view details
2.1 47-350 304 351-392 1-26 27-46 26 41 slipknot
view details
2.1 47-300 254 1-27, 341-392 28-46, 301-340 27 52 slipknot
view details
2.1 46-262 217 1-28, 282-392 29-45, 263-281 28 111 slipknot
view details
1.1 47-249 203 1-29, 262-392 30-46, 250-261 29 131 slipknot
view details
1.1 85-249 165 1-65, 263-392 66-84, 250-262 65 130 slipknot
view details
2.1 80-262 183 1-66, 278-392 67-79, 263-277 66 115 slipknot
view details
2.1 101-297 197 1-66, 341-392 67-100, 298-340 66 52 slipknot
view details
2.1 100-346 247 347-392 1-66 67-99 66 45 slipknot
view details
2.1 94-275 182 1-72, 297-392 73-93, 276-296 72 96 slipknot
sequence length 392
structure length 385
publication title Structural mechanism of the active bicarbonate transporter from cyanobacteria
doi rcsb
molecule tags Transport protein
molecule keywords Low affinity sulfate transporter
source organism Synechocystis sp. pcc 6803
missing residues 189-191, 363-366
total genus Genus: 131
ec nomenclature
pdb deposition date 2019-07-17
KnotProt deposition date 2019-11-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00916 Sulfate_transp Sulfate permease family
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the KnotProt database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

  
#similar chains in the KnotProt database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...
How to cite
KnotProt | Interdisciplinary Laboratory of Biological Systems Modelling