6KLMA

Nmr solution structure of roseltide rt7
Cysteine knot
Loop Piercing
view details
1-c-10-b-19-c-14 13-b-32
Chain Sequence
CVSSGIVDACSECCEPDKCIIMLPTWPPRYVCSV
sequence length 34
structure length 34
publication title Roseltide rT7 is a disulfide-rich, anionic, and cell-penetrating peptide that inhibits proteasomal degradation
rcsb
molecule tags Plant protein
molecule keywords Roseltide rT7
ec nomenclature
pdb deposition date 2019-07-30
Image from the rcsb pdb (www.rcsb.org)
None
similar chains in the KnotProt database (40% sequence similarity)
None
similar chains in the pdb database (40% sequence similarity)

 
#similar chains in the KnotProt database (40% sequence similarity)

#similar chains, but unknotted

#similar chains in the pdb database (40% sequence similarity)


KnotProt | Interdisciplinary Laboratory of Biological Systems Modelling
Application loaded.