| Loop | Piercing | ||||
|---|---|---|---|---|---|
| view details | 1-c-10-b-19-c-14 | 13-b-32 |
Chain Sequence |
CVSSGIVDACSECCEPDKCIIMLPTWPPRYVCSV
|
| sequence length |
34
|
| structure length |
34
|
| publication title |
Roseltide rT7 is a disulfide-rich, anionic, and cell-penetrating peptide that inhibits proteasomal degradation
rcsb |
| molecule tags |
Plant protein
|
| molecule keywords |
Roseltide rT7
|
| ec nomenclature | |
| pdb deposition date | 2019-07-30 |
Image from the rcsb pdb (www.rcsb.org)
#similar chains in the KnotProt database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unknotted ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...
