6L71A

Sirtuin 2 demyristoylation native intermediate i & ii mixture
Cysteine knot
Loop Piercing
view details
195-c-200-b-221-c-200 200-b-224
Chain Sequence
SQKERLLDELTLEGVARYMQSERCRRVICLVGAGISTSAGIPDFRSPSTGLYDNLEKYHLPYPEAIFEISYFKKHPEPFFALAKELYPGQFKPTICHYFMRLLKDKGLLLRCYTQNIDTLERIAGLEQEDLVEAHGTFYTSHCVSASCRHEYPLSWMKEKIFSEVTPKCEDCQSLVKPDIVFFGESLPARFFSCMQSDFLKVDLLLVMGTSLQVQPFASLISKAPLSTPRLLINKEKAGQSDPFLG-------GMDFDSKKAYRDVAWLGECDQGCLALAELLGWKKELEDLVRREHASIDAQ
sequence length 303
structure length 296
publication title Sirtuin 2 protein with H3K18 myristoylated peptide
rcsb
molecule tags Transferase
molecule keywords NAD-dependent protein deacetylase sirtuin-2
source organism Homo sapiens
missing residues 246-252
ec nomenclature ec 2.3.1.286: Protein acetyllysine N-acetyltransferase.
pdb deposition date 2019-10-30
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the KnotProt database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the KnotProt database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...

KnotProt | Interdisciplinary Laboratory of Biological Systems Modelling