| Loop | Piercing | ||||
|---|---|---|---|---|---|
| view details | 2-c-7-b-32-c-11 | 8-b-37 |
Chain Sequence |
EFECESGPCCRNCKFLKEGTICKRARGDDMDDYCNGKTCDCPRNPHK
|
| sequence length |
47
|
| structure length |
47
|
| publication title |
Structural Insight into Integrin Recognition and Anticancer Activity of Echistatin.
pubmed doi rcsb |
| molecule tags |
Blood clotting
|
| molecule keywords |
Disintegrin
|
| source organism |
Echis carinatus
|
| ec nomenclature | |
| pdb deposition date | 2020-01-19 |
Image from the rcsb pdb (www.rcsb.org)
#similar chains in the KnotProt database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unknotted ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...
