6MACA

Ternary structure of gdf11 bound to actriib-ecd and alk5-ecd
Cysteine knot
Loop Piercing
view details
43-c-47-b-108-c-106 15-b-74
Chain Sequence
LGLDCDEHSSESRCCRYPLTVDFEAFGWDWIIAPKRYKANYCSGQCEYMFMQKYPHTHLVQQANPRGSAGPCCTPTKMSPINMLYFNDKQQIIYGKIPGMVVDRCGCS
sequence length 108
structure length 108
publication title Structural characterization of an activin class ternary receptor complex reveals a third paradigm for receptor specificity.
pubmed doi rcsb
molecule tags Signaling protein
molecule keywords Growth/differentiation factor 11
source organism Homo sapiens
ec nomenclature
pdb deposition date 2018-08-27
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the KnotProt database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the KnotProt database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...

KnotProt | Interdisciplinary Laboratory of Biological Systems Modelling