6MK4A

Solution nmr structure of spider toxin analogue [e17k]protx-ii
Cysteine knot
Loop Piercing
view details
2-c-9-b-21-c-16 15-b-25
Chain Sequence
YCQKWMWTCDSERKCCKGMVCRLWCKKKLW
sequence length 30
structure length 30
publication title Peptide-membrane interactions affect the inhibitory potency and selectivity of spider toxins ProTx-II and GpTx-1.
pubmed doi rcsb
molecule tags Toxin
molecule keywords Beta/omega-theraphotoxin-Tp2a
ec nomenclature
pdb deposition date 2018-09-25
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the KnotProt database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the KnotProt database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...

KnotProt | Interdisciplinary Laboratory of Biological Systems Modelling