6MK5A

Solution nmr structure of spider toxin analogue [f5a,m6f,t26l,k28r]gptx-1
Cysteine knot
Loop Piercing
view details
2-c-9-b-23-c-17 16-b-30
Chain Sequence
DCLGAFRKCIPDNDKCCRPNLVCSRLHRWCKYVF
sequence length 34
structure length 34
publication title Peptide-membrane interactions affect the inhibitory potency and selectivity of spider toxins ProTx-II and GpTx-1.
pubmed doi rcsb
molecule tags Toxin
molecule keywords Toxin GTx1-15
ec nomenclature
pdb deposition date 2018-09-25
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the KnotProt database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the KnotProt database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...

KnotProt | Interdisciplinary Laboratory of Biological Systems Modelling