| Loop | Piercing | ||||
|---|---|---|---|---|---|
| view details | 2-c-9-b-23-c-17 | 16-b-30 |
Chain Sequence |
DCLGAFRKCIPDNDKCCRPNLVCSRLHRWCKYVF
|
| sequence length |
34
|
| structure length |
34
|
| publication title |
Peptide-membrane interactions affect the inhibitory potency and selectivity of spider toxins ProTx-II and GpTx-1.
pubmed doi rcsb |
| molecule tags |
Toxin
|
| molecule keywords |
Toxin GTx1-15
|
| ec nomenclature | |
| pdb deposition date | 2018-09-25 |
Image from the rcsb pdb (www.rcsb.org)
#similar chains in the KnotProt database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unknotted ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...
