| Loop | Piercing | ||||
|---|---|---|---|---|---|
| view details | 12-c-26-b-31-c-31 | 9-b-26 |
Chain Sequence |
GRYIGPVCRLCRREGVKLYLKGERCYSPKCAMERRPYPPGQHGQKRARRPSDYAVRLREKQKLRRIYGISERQFRNLFEEASKKKGVTGSVFLGLLESRLDNVVYRLGFAVSRRQARQLVRHGHITVNGRRVDLPSYRVRPGDEIAVAEKSRNLELIRQNLEAMKGRKVGPWLSLDVEGMKGKFLRLPDREDLALPVNEQLVIEFYSR
|
| sequence length |
208
|
| structure length |
208
|
| publication title |
A structural basis for restricted codon recognition mediated by 2-thiocytidine in tRNA containing a wobble position inosine
rcsb |
| molecule tags |
Ribosome
|
| molecule keywords |
16S rRNA
|
| ec nomenclature | |
| pdb deposition date | 2018-09-25 |
Image from the rcsb pdb (www.rcsb.org)
#similar chains in the KnotProt database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unknotted ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...
