6MKNN

Structure of the thermus thermophilus 30s ribosomal subunit complexed with an inosine (i34) modified anticodon stem loop (asl) of escherichia coli transfer rna arginine 2 (trnaarg2) bound to an mrna with an cgu-codon in the a-site and paromomycin
Cysteine knot
Loop Piercing
view details
24-c-27-b-43-c-43 24-b-40
Chain Sequence
ARKALIEKAKRTPKFKVRAYTRCVRCGRARSVYRFFGLCRICLRELAHKGQLPGVRKASW
sequence length 60
structure length 60
publication title A structural basis for restricted codon recognition mediated by 2-thiocytidine in tRNA containing a wobble position inosine
rcsb
molecule tags Ribosome
molecule keywords 16S rRNA
ec nomenclature
pdb deposition date 2018-09-25
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the KnotProt database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the KnotProt database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...

KnotProt | Interdisciplinary Laboratory of Biological Systems Modelling