6MLKA

Structure of thioesterase from debs with a thioesterase-specific antibody
Warning
  • Chain breaks within knot 31 (displayed as a gray area on the plot and as '-' on the sequence). The broken part of the chain has been replaced by a straight segment, which may affect what knot types are detected - be careful with interpreting results.
Genus: 85
Slipknot S +31

  Help Knotting data interpretation Full screen
Knot core range Knot core length Knot tails range Slipknot tails range Slipknot loops range N-end length C-end length Type
view details
+31 49-242 194 1-5, 249-264 6-48, 243-248 5 16 slipknot
Chain Sequence
SALRDGYRQAGVSGRVRSYLDLLAGLSDFREHFD---GFSLDLVDMGPG--EVTVICCAGTAAISGPHEFTRLAGALRGIAPVRAVPQPGYEEGEPLPSSMAAVAAVQADAVIRTQKPFVV--AGHSAGALMAYALATELLDRGHPPRGVVLIDVYPPGHQDAMNAWLEELTATLFDRETVRMDDTRLTALGAYDRLTGQWRPRETGLPTLLVSAGEPMGPWPDDSWKPTWPFEHDTVAVPGDHFTMVQEHADAIARHIDAWLG
Whole chain analysis

  Help Knotoid data interpretation Full screen
Subchain analysis 

Knotoid cutoff: 0.5


Knotoid matrix content: 1


  Help Knotoid subchains data interpretation Full screen
Knot core range Knot core length Knot tails range Slipknot tails range Slipknot loops range N-end length C-end length Type
sequence length 264
structure length 257
publication title Discovery and characterization of a thioesterase-specific monoclonal antibody that recognizes the 6-deoxyerythronolide B synthase.
pubmed doi rcsb
molecule tags Transferase
molecule keywords 6-deoxyerythronolide-B synthase EryA3, modules 5 and 6
source organism Saccharopolyspora erythraea
missing residues 35-37, 47-48, 117-118
total genus Genus: 85
ec nomenclature
pdb deposition date 2018-09-27
KnotProt deposition date 2018-10-21
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the KnotProt database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

  
#similar chains in the KnotProt database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...
How to cite
KnotProt | Interdisciplinary Laboratory of Biological Systems Modelling