| Loop | Piercing | ||||
|---|---|---|---|---|---|
| view details | 2-c-14-b-26-c-24 | 20-b-32 |
Chain Sequence |
CPRPRGDNPPLTCKQDSDCLAGCVCGPNGFCG
|
| sequence length |
32
|
| structure length |
32
|
| publication title |
Integrin AlphaVBeta3 ectodomain bound EETI-II 2.5F
rcsb |
| molecule tags |
Cell adhesion
|
| molecule keywords |
Integrin alpha-V
|
| source organism |
Homo sapiens
|
| ec nomenclature | |
| pdb deposition date | 2018-10-18 |
Image from the rcsb pdb (www.rcsb.org)
#similar chains in the KnotProt database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unknotted ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...
