6MV6A

Crystal structure of rnase 6
Cysteine knot
Loop Piercing
view details
37-c-55-b-106-c-91 23-b-81
Chain Sequence
AKRLTKAHWFEIQHIQPSPLQCNRAMSGINNYTQHCKHQNTFLHDSFQNVAAVCDLLSIVCKNRRHNCHQSSKPVNMTDCRLTY---PQCRYSAAAQYKFFIVACDPPQKSDPPYKLVPVHLDSIL
sequence length 126
structure length 123
publication title Crystal structure of RNAse 6
rcsb
molecule tags Hydrolase
molecule keywords Ribonuclease K6
source organism Homo sapiens
missing residues 84-86
ec nomenclature
pdb deposition date 2018-10-24
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the KnotProt database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the KnotProt database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...

KnotProt | Interdisciplinary Laboratory of Biological Systems Modelling