| Loop | Piercing | ||||
|---|---|---|---|---|---|
| view details | 2-c-9-b-21-c-16 | 15-b-25 |
Chain Sequence |
YCQKWMWTCDSERKCCEGMVCRLWCKKKLW
|
| sequence length |
30
|
| structure length |
30
|
| publication title |
Structural Basis of Nav1.7 Inhibition by a Gating-Modifier Spider Toxin.
pubmed doi rcsb |
| molecule tags |
Membrane protein
|
| molecule keywords |
Nav1.7 VSD2-NavAb chimera
|
| source organism |
Arcobacter butzleri (strain rm4018)
|
| ec nomenclature | |
| pdb deposition date | 2018-11-20 |
Image from the rcsb pdb (www.rcsb.org)
#similar chains in the KnotProt database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unknotted ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...
