6NJ4A

Thermostable variant of human carbonic anhydrase with disordered tetrazine 2.0 reacted with strained trans-cyclooctene at site 233
Warning
  • Chain breaks within knot 31 (displayed as a gray area on the plot and as '-' on the sequence). The broken part of the chain has been replaced by a straight segment, which may affect what knot types are detected - be careful with interpreting results.
Genus: 73
Knot K +31

  Help Knotting data interpretation Full screen
Knot core range Knot core length Knot tails range Slipknot tails range Slipknot loops range N-end length C-end length Type
view details
+31 28-254 227 1-27, 255-266 27 12 knot
Chain Sequence
AHHWGYGKHNGPEHWHKDFPIAKGERQSPVDIDTHTAKYDPSLKPLSVSYDQATSLRILNNGHTFNVEFDDSQDKAVLKGGPLDGTYRLIQFHFHWGSHDGQGSEHTVDKKKYAAELHLVHWNTKYGDFGKAVQQPDGLAVLGIFLKVGSANPGLQKVVDVLDSIKTKGKSADFTNFDPRGLLPESLDYWTYPGSLTTPPLLECVTWIVLKEPISVSSEQVSKFRKLNFNG-GEPEEPMVDNWRPTQPLKNRQIKASFKHHHHHH
Note, that the numbers in the matrix denote the consecutive residues in the loop, not the index of amino acids in the chain!
Knot K 3x +31

  Help Knotting data interpretation Full screen
Knot core range Knot core length Knot tails range Slipknot tails range Slipknot loops range N-end length C-end length Type
+ 31 28-256 229 1-27, 257-266 27 10 knot
Fingerprint Knot forming loop Loop type
K +31 Ala1 ... His93 <->
Bridging ionZn301
<-> His95 ...
Chain closureHis266 <-> Ala1
 probabilistic
K +31
Chain closureAla1 <-> His266
... His118 <->
Bridging ionZn301
<-> His95 ... Ala1		 probabilistic
K +31 Ala1 ... His93 <->
Bridging ionZn301
<-> His118 ...
Chain closureHis266 <-> Ala1
 probabilistic
Chain Sequence
AHHWGYGKHNGPEHWHKDFPIAKGERQSPVDIDTHTAKYDPSLKPLSVSYDQATSLRILNNGHTFNVEFDDSQDKAVLKGGPLDGTYRLIQFHFHWGSHDGQGSEHTVDKKKYAAELHLVHWNTKYGDFGKAVQQPDGLAVLGIFLKVGSANPGLQKVVDVLDSIKTKGKSADFTNFDPRGLLPESLDYWTYPGSLTTPPLLECVTWIVLKEPISVSSEQVSKFRKLNFNG-GEPEEPMVDNWRPTQPLKNRQIKASFKHHHHHH
Whole chain analysis

  Help Knotoid data interpretation Full screen
Subchain analysis 

Knotoid cutoff: 0.5


Knotoid matrix content: 1


  Help Knotoid subchains data interpretation Full screen
Knot core range Knot core length Knot tails range Slipknot tails range Slipknot loops range N-end length C-end length Type
view details
3.1 28-257 230 1-27, 258-265 27 8 knot
view details
2.1 26-253 228 1-25 259-265 254-258 25 7 slipknot
view details
2.1 31-260 230 261-265 1-27 28-30 27 4 slipknot
sequence length 265
structure length 264
publication title Immobilization of Proteins with Controlled Load and Orientation.
pubmed doi rcsb
molecule tags Lyase
molecule keywords Carbonic anhydrase 2
source organism Homo sapiens
missing residues 232
total genus Genus: 73
ec nomenclature ec 4.2.1.1: Alcohol dehydrogenase.
pdb deposition date 2019-01-02
KnotProt deposition date 2019-10-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00194 Carb_anhydrase Eukaryotic-type carbonic anhydrase
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the KnotProt database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

  
#similar chains in the KnotProt database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...
How to cite
KnotProt | Interdisciplinary Laboratory of Biological Systems Modelling