6NPHA

Structure of nkcc1 tm domain
Slipknot S 41 +31 +31 +31
Knot core range Knot core length Knot tails range Slipknot tails range Slipknot loops range N-end length C-end length Type
view details
+31 32-224 193 225-472 1-18 19-31 18 247 slipknot
view details
41 14-262 249 1-13 323-472 263-322 13 150 slipknot
Chain Sequence
KFGWIKGVLVRCMLNIWGVMLFIRMTWIVGQAGIAYSCIIVIMATVVTTITGCSTSAIATNGFVRGGGAYYLISRSLGPEFGGSIGLIFAFANAVAVAMYVVGFAETVVELLMDSGLLMIDQTNDIRVIGTITVILLLGISVAGMEWEAKAQIFLLVILITAIFNYFIGSFIAVDSKKKFGFFSYDAGILAENFGPDFRGQTFFSVFSIFFPAATGILAGANISGDLADPQMAIPKGTLLAILITGLVYVGVAISAGACIVRDATGIESNFTLISNCTDAACKYGYDFSSCRPTVEGEVSSCKFGLHNDFQVMSVVSGFSPLISAGIFSATLSSALASLVSAPKVFQALCKDNIYPGIAIFGKGYGKNNEPLRGYFLTFGIALAFILIAELNVIAPIISNFFLASYALINFSVFHASLANSPGWRPSFKYYNMWASLAGAILCCVVMFIINWWAALLTNVIVLSLYIYVSYK
Whole chain analysis
Subchain analysis 

Knotoid cutoff: 0.5


Knotoid matrix content: 1

Knot core range Knot core length Knot tails range Slipknot tails range Slipknot loops range N-end length C-end length Type
view details
3.2 8-254 247 1-7 262-472 255-261 7 211 slipknot
view details
4.1 9-261 253 1-8 304-472 262-303 8 169 slipknot
view details
3.2 17-307 291 1-16 332-472 308-331 16 141 slipknot
view details
1.1 35-240 206 1-13, 260-472 14-34, 241-259 13 213 slipknot
view details
2.1 35-214 180 1-14, 239-472 15-34, 215-238 14 234 slipknot
view details
2.1 35-238 204 1-14, 241-472 15-34, 239-240 14 232 slipknot
view details
2.1 34-336 303 1-14, 388-472 15-33, 337-387 14 85 slipknot
view details
2.1 35-406 372 407-472 1-14 15-34 14 65 slipknot
publication title Structure and mechanism of the cation-chloride cotransporter NKCC1.
pubmed doi rcsb
structure length 472
molecule tags Membrane protein
source organism Danio rerio
sequence length 472
molecule keywords Solute carrier family 12 (sodium/potassium/chloride transporter), member 2
ec nomenclature
pdb deposition date 2019-01-17
KnotProt deposition date 2019-09-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03522 SLC12 Solute carrier family 12
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the KnotProt database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the KnotProt database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...

KnotProt | Interdisciplinary Laboratory of Biological Systems Modelling