6NPKA

Structure of the tm domain
Slipknot S 41 +31 +31 +31
Knot core range Knot core length Knot tails range Slipknot tails range Slipknot loops range N-end length C-end length Type
view details
+31 32-225 194 1-18, 471-472 19-31, 226-470 18 2 slipknot
view details
41 14-262 249 1-13 324-472 263-323 13 149 slipknot
Chain Sequence
KFGWIKGVLVRCMLNIWGVMLFIRMTWIVGQAGIAYSCIIVIMATVVTTITGCSTSAIATNGFVRGGGAYYLISRSLGPEFGGSIGLIFAFANAVAVAMYVVGFAETVVELLMDSGLLMIDQTNDIRVIGTITVILLLGISVAGMEWEAKAQIFLLVILITAIFNYFIGSFIAVDSKKKFGFFSYDAGILAENFGPDFRGQTFFSVFSIFFPAATGILAGANISGDLADPQMAIPKGTLLAILITGLVYVGVAISAGACIVRDATGIESNFTLISNCTDAACKYGYDFSSCRPTVEGEVSSCKFGLHNDFQVMSVVSGFSPLISAGIFSATLSSALASLVSAPKVFQALCKDNIYPGIAIFGKGYGKNNEPLRGYFLTFGIALAFILIAELNVIAPIISNFFLASYALINFSVFHASLANSPGWRPSFKYYNMWASLAGAILCCVVMFIINWWAALLTNVIVLSLYIYVSYK
Whole chain analysis
Subchain analysis 

Knotoid cutoff: 0.5


Knotoid matrix content: 1

Knot core range Knot core length Knot tails range Slipknot tails range Slipknot loops range N-end length C-end length Type
view details
3.2 8-254 247 1-7 263-472 255-262 7 210 slipknot
view details
4.1 8-262 255 1-7 306-472 263-305 7 167 slipknot
view details
3.2 16-308 293 1-15 330-472 309-329 15 143 slipknot
view details
2.1 35-215 181 1-14, 243-472 15-34, 216-242 14 230 slipknot
view details
1.1 35-242 208 1-14, 258-472 15-34, 243-257 14 215 slipknot
view details
2.1 35-337 303 1-14, 389-472 15-34, 338-388 14 84 slipknot
view details
2.1 35-406 372 407-472 1-14 15-34 14 65 slipknot
view details
1.1 29-212 184 1-19, 216-472 20-28, 213-215 19 257 slipknot
view details
1.1 31-212 182 1-28, 216-472 29-30, 213-215 28 257 slipknot
publication title Structure and mechanism of the cation-chloride cotransporter NKCC1.
pubmed doi rcsb
structure length 472
molecule tags Membrane protein
source organism Danio rerio
sequence length 472
molecule keywords Solute carrier family 12 (sodium/potassium/chloride transporter), member 2
ec nomenclature
pdb deposition date 2019-01-17
KnotProt deposition date 2019-09-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03522 SLC12 Solute carrier family 12
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the KnotProt database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the KnotProt database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...

KnotProt | Interdisciplinary Laboratory of Biological Systems Modelling