| Loop | Piercing | ||||
|---|---|---|---|---|---|
| view details | 67-c-71-b-138-c-136 | 38-b-104 |
Chain Sequence |
TACRKHELYVSFQDLGWQDWIIAPKGYAANYCDGECSFPLNAHMNATNHAIVQTLVHLMNPEYVPKPCCAPTKLNAISVLYFDDNSNVILKKYRNMVVRACGCH
|
| sequence length |
104
|
| structure length |
104
|
| publication title |
A BMP/activin A chimera is superior to native BMPs and induces bone repair in nonhuman primates when delivered in a composite matrix.
pubmed doi rcsb |
| molecule tags |
Cytokine
|
| molecule keywords |
Bone morphogenetic protein 6
|
| source organism |
Homo sapiens
|
| ec nomenclature | |
| pdb deposition date | 2019-04-19 |
Image from the rcsb pdb (www.rcsb.org)
#similar chains in the KnotProt database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unknotted ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...
