6PVWA

Rnase a in complex with cp4pa
Cysteine knot
Loop Piercing
view details
40-c-58-b-110-c-95 26-b-84
Chain Sequence
KETAAAKFERQHMDSSTSAASSSNYCNQMMKSRNLTKDRCKPVNTFVHESLADVQAVCSQKNVACKNGQTNCYQSYSTMSITDCRETGSSKYPNCAYKTTQANKHIIVACEGNPYVPVHFDASV
sequence length 124
structure length 124
publication title Nucleoside Tetra- and Pentaphosphates Prepared Using a Tetraphosphorylation Reagent are Potent Inhibitors of Ribonuclease A.
pubmed doi rcsb
molecule tags Lyase
molecule keywords Ribonuclease pancreatic
ec nomenclature ec 4.6.1.18: Alcohol dehydrogenase.
pdb deposition date 2019-07-21
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the KnotProt database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the KnotProt database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...

KnotProt | Interdisciplinary Laboratory of Biological Systems Modelling