6PX7A

Dg12a in weaponisation 'on the fly': convergent recruitment of knottin and defensin scaffolds as neurotoxins in the venom of assassin fly dolopus genitalis (diptera: asilidae)
Cysteine knot
Loop Piercing
view details
7-c-14-b-25-c-21 20-b-32
Chain Sequence
SQEQRQCKKIGEHCYVADECCSKRCLFYAAKCVS
sequence length 34
structure length 34
publication title Weaponisation 'on the fly': convergent recruitment of knottin and defensin peptide scaffolds into the venom of predatory assassin flies.
pubmed doi rcsb
molecule tags Toxin
molecule keywords Venom polypeptide
source organism Dolopus genitalis
ec nomenclature
pdb deposition date 2019-07-25
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the KnotProt database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the KnotProt database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...

KnotProt | Interdisciplinary Laboratory of Biological Systems Modelling