| Loop | Piercing | ||||
|---|---|---|---|---|---|
| view details | 7-c-14-b-25-c-21 | 20-b-32 |
Chain Sequence |
SQEQRQCKKIGEHCYVADECCSKRCLFYAAKCVS
|
| sequence length |
34
|
| structure length |
34
|
| publication title |
Weaponisation 'on the fly': convergent recruitment of knottin and defensin peptide scaffolds into the venom of predatory assassin flies.
pubmed doi rcsb |
| molecule tags |
Toxin
|
| molecule keywords |
Venom polypeptide
|
| source organism |
Dolopus genitalis
|
| ec nomenclature | |
| pdb deposition date | 2019-07-25 |
Image from the rcsb pdb (www.rcsb.org)
#similar chains in the KnotProt database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unknotted ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...
