| Loop | Piercing | ||||
|---|---|---|---|---|---|
| view details | 240-c-244-b-307-c-305 | 211-b-274 |
Chain Sequence |
DHCPLGPGRCCRLHTVRASLEDLGWADWVLSPREVQVTMCIGACPSQFRAANMHAQIKTSLHRLKPDTVPAPCCVPASYNPMVLIQKTDTGVSLQTYDDLLAKDCHCI
|
| sequence length |
108
|
| structure length |
108
|
| publication title |
Cryo-EM analyses reveal the common mechanism and diversification in the activation of RET by different ligands.
pubmed doi rcsb |
| molecule tags |
Signaling protein
|
| molecule keywords |
Growth/differentiation factor 15
|
| source organism |
Homo sapiens
|
| ec nomenclature | |
| pdb deposition date | 2019-08-08 |
Image from the rcsb pdb (www.rcsb.org)
#similar chains in the KnotProt database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unknotted ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...
