6Q2OA

Cryo-em structure of ret/gfra2/nrtn extracellular complex. the 3d refinement was applied with c2 symmetry.
Cysteine knot
Loop Piercing
view details
130-c-134-b-196-c-194 103-b-165
Chain Sequence
ARPCGLRELEVRVSELGLGYASDETVLFRYCAGACEAAARVYDLGLRRLRQRRRLRRERVRAQPCCRPTAYEDEVSFLDAHSRYHTVHELSARECACV
sequence length 98
structure length 98
publication title Cryo-EM analyses reveal the common mechanism and diversification in the activation of RET by different ligands.
pubmed doi rcsb
molecule tags Signaling protein
molecule keywords Neurturin
source organism Homo sapiens
ec nomenclature
pdb deposition date 2019-08-08
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the KnotProt database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the KnotProt database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...

KnotProt | Interdisciplinary Laboratory of Biological Systems Modelling
Application loaded.