| Loop | Piercing | ||||
|---|---|---|---|---|---|
| view details | 150-c-154-b-218-c-216 | 123-b-188 |
Chain Sequence |
GCRLRSQLVPVRALGLGHRSDELVRFRFCSGSCRRARSPHDLSLASLLGAGALRPPPGSRPVSQPCCRPTRYEAVSFMDVNSTWRTVDRLSATACGCL
|
| sequence length |
98
|
| structure length |
98
|
| publication title |
Cryo-EM analyses reveal the common mechanism and diversification in the activation of RET by different ligands.
pubmed doi rcsb |
| molecule tags |
Signaling protein
|
| molecule keywords |
Ubiquitin-like protein SMT3,Artemin
|
| source organism |
Saccharomyces cerevisiae
|
| ec nomenclature | |
| pdb deposition date | 2019-08-08 |
Image from the rcsb pdb (www.rcsb.org)
#similar chains in the KnotProt database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unknotted ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...
