Loop | Piercing | ||||
---|---|---|---|---|---|
view details | 150-c-154-b-218-c-216 | 123-b-188 |
Chain Sequence |
GCRLRSQLVPVRALGLGHRSDELVRFRFCSGSCRRARSPHDLSLASLLGAGALRPPPGSRPVSQPCCRPTRYEAVSFMDVNSTWRTVDRLSATACGCL
|
sequence length |
98
|
structure length |
98
|
publication title |
Cryo-EM analyses reveal the common mechanism and diversification in the activation of RET by different ligands.
pubmed doi rcsb |
molecule tags |
Signaling protein
|
molecule keywords |
Ubiquitin-like protein SMT3,Artemin
|
source organism |
Saccharomyces cerevisiae
|
ec nomenclature | |
pdb deposition date | 2019-08-08 |
#similar chains in the KnotProt database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unknotted ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...