6QETA

[41-82]gga-avbd11
Cysteine knot
Loop Piercing
view details
16-c-23-b-39-c-31 9-b-31
Chain Sequence
DTTSDFHTCQDKGGHCVSPKIRCLEEQLGLCPLKRWTCCKEI
sequence length 42
structure length 42
publication title Structure, function, and evolution ofGga-AvBD11, the archetype of the structural avian-double-beta-defensin family.
pubmed doi rcsb
molecule tags Antimicrobial protein
molecule keywords Gallinacin-11
ec nomenclature
pdb deposition date 2019-01-08
Image from the rcsb pdb (www.rcsb.org)
None 6QEUA
similar chains in the KnotProt database (40% sequence similarity)
None
similar chains in the pdb database (40% sequence similarity)

 
#similar chains in the KnotProt database (40% sequence similarity)

#similar chains, but unknotted
6QEU A; 
#similar chains in the pdb database (40% sequence similarity)


KnotProt | Interdisciplinary Laboratory of Biological Systems Modelling
Application loaded.