6QKLH

Mechanism of eif6 release from the nascent 60s ribosomal subunit
Cysteine knot
Loop Piercing
view details
19-c-22-b-33-c-22 22-b-38
Chain Sequence
IEPSLVILARKYKCDKMICRKCYARLHPRAVNCRKKKCGHSNNLRPKKKLL
sequence length 51
structure length 51
publication title Mechanism of eIF6 release from the nascent 60S ribosomal subunit.
pubmed doi rcsb
molecule tags Ribosome
molecule keywords 26S RIBOSOMAL RNA
source organism Homo sapiens
ec nomenclature
pdb deposition date 2019-01-29
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the KnotProt database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the KnotProt database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...

KnotProt | Interdisciplinary Laboratory of Biological Systems Modelling