| Loop | Piercing | ||||
|---|---|---|---|---|---|
| view details | 40-c-58-b-110-c-95 | 26-b-84 |
Chain Sequence |
KETAAAKFERQHMDSSTSAASSSNYCNQMMKSRNLTKDRCKPVNTFVHESLADVQAVCSQKNVACKNGQTNCYQSYSTMSITDCRETGSSKYPNCAYKTTQANKHIIVACENQAPVHFDASV
|
| sequence length |
122
|
| structure length |
122
|
| publication title |
Structure, stability and aggregation propensity of a Ribonuclease A-Onconase chimera.
pubmed doi rcsb |
| molecule tags |
Hydrolase
|
| molecule keywords |
Ribonuclease pancreatic
|
| source organism |
Bison bison
|
| ec nomenclature | |
| pdb deposition date | 2019-02-07 |
Image from the rcsb pdb (www.rcsb.org)
#similar chains in the KnotProt database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unknotted ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...