| Knot core range | Knot core length | Knot tails range | Slipknot tails range | Slipknot loops range | N-end length | C-end length | Type | |||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| view details |
 |
+31 | 84-132 | 49 | 1-83, 133-229 | 83 | 97 | knot |
Chain Sequence |
GSMKIDVVTIFPEYLQPVRQSLPGKAIDAGLVDVAVHDLRRWTHDVHKSVDDSPYGGGPGMVMKPTVWGDALDEICTSETLLVVPTPAGYPFTQETAWQWSTEDHLVIACGRYEGIDQRVADDAATRMRVREVSIGDYVLNGGEAAALVIIEAVLRLVPGVLGNALSAQ---------SLLEGPSYTRPPSWRGMDVPPVLLSGDHAKIAAWRAEQSRQRTIERRPDLL
|
| sequence length |
229
|
| structure length |
220
|
| publication title |
Development of Inhibitors against Mycobacterium abscessus tRNA (m 1 G37) Methyltransferase (TrmD) Using Fragment-Based Approaches.
pubmed doi rcsb |
| molecule tags |
Transferase
|
| molecule keywords |
tRNA (guanine-N(1)-)-methyltransferase
|
| source organism |
Mycobacterium abscessus
|
| missing residues |
170-178
|
| total genus |
 Genus: 55
|
| ec nomenclature |
ec
2.1.1.228: tRNA (guanine(37)-N(1))-methyltransferase. |
| pdb deposition date | 2019-02-19 |
| KnotProt deposition date | 2021-05-27 |
| chain | Pfam Accession Code | Pfam Family Identifier | Pfam Description |
|---|---|---|---|
| A | PF01746 | tRNA_m1G_MT | tRNA (Guanine-1)-methyltransferase |
Image from the rcsb pdb (www.rcsb.org)
#similar chains in the KnotProt database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unknotted ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...
