| Knot core range | Knot core length | Knot tails range | Slipknot tails range | Slipknot loops range | N-end length | C-end length | Type | |||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| view details |
|
+31 | 25-248 | 224 | 1-24, 249-256 | 24 | 8 | knot |
Chain Sequence |
HWRYGGDPPWPRVSPACAGRFQSPVDIRPQLAAFSPALRPLELSGFQLPPLPELRLRNNGHSVQLTLPPGLEMKLGPGREYRALQLHLHWGAAGRPGSEHTVEGHRFPAEIHVVHLSTKYARVDEALGRPGGLAVLAAFLEEGPEENSAYEQLLSRLEEIAEEGSETQVPGLDISALLPSDFSRYFQYEGSLTTPPCAQGVIWTVFNQTVSLSAKQLHTLSDTLWGPGDSRLQLNFRATQPLNGRVIEASFPAGVD
|
| Knot core range | Knot core length | Knot tails range | Slipknot tails range | Slipknot loops range | N-end length | C-end length | Type | ||||
|---|---|---|---|---|---|---|---|---|---|---|---|
|
|
+ 31 | 22-248 | 227 | 1-21, 249-256 | 21 | 8 | knot |
| Fingerprint | Knot forming loop | Loop type | ||||
|---|---|---|---|---|---|---|
|
|
K +31 | Chain closureHis140 <-> Asp395 ... His228 <-> Bridging ionZn401 <-> His226 ... His140 |
probabilistic | |||
|
|
K +31 | Chain closureHis140 <-> Asp395 ... His251 <-> Bridging ionZn401 <-> His228 ... His140 |
probabilistic | |||
|
|
K +31 | Chain closureHis140 <-> Asp395 ... His251 <-> Bridging ionZn401 <-> His226 ... His140 |
probabilistic |
Chain Sequence |
HWRYGGDPPWPRVSPACAGRFQSPVDIRPQLAAFSPALRPLELSGFQLPPLPELRLRNNGHSVQLTLPPGLEMKLGPGREYRALQLHLHWGAAGRPGSEHTVEGHRFPAEIHVVHLSTKYARVDEALGRPGGLAVLAAFLEEGPEENSAYEQLLSRLEEIAEEGSETQVPGLDISALLPSDFSRYFQYEGSLTTPPCAQGVIWTVFNQTVSLSAKQLHTLSDTLWGPGDSRLQLNFRATQPLNGRVIEASFPAGVD
|
Knotoid cutoff: 0.5


Knotoid matrix content: 1
| Knot core range | Knot core length | Knot tails range | Slipknot tails range | Slipknot loops range | N-end length | C-end length | Type | |||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| view details |
|
3.1 | 23-250 | 228 | 1-22, 251-256 | 22 | 6 | knot | ||||
| view details |
|
2.1 | 22-246 | 225 | 1-21 | 251-256 | 247-250 | 21 | 6 | slipknot |
| sequence length |
256
|
| structure length |
256
|
| publication title |
Structural comparison of protiated, H/D-exchanged and deuterated human carbonic anhydrase IX
doi rcsb |
| molecule tags |
Proton transport
|
| molecule keywords |
Carbonic anhydrase 9
|
| source organism |
Homo sapiens
|
| total genus |
Genus: 68
|
| ec nomenclature |
ec
4.2.1.1: Alcohol dehydrogenase. |
| pdb deposition date | 2019-05-16 |
| KnotProt deposition date | 2019-09-21 |
| chain | Pfam Accession Code | Pfam Family Identifier | Pfam Description |
|---|---|---|---|
| A | PF00194 | Carb_anhydrase | Eukaryotic-type carbonic anhydrase |
Image from the rcsb pdb (www.rcsb.org)
#similar chains in the KnotProt database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unknotted ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...