6SCFA

A viral anti-crispr subverts type iii crispr immunity by rapid degradation of cyclic oligoadenylate
Slipknot S +31
Knot core range Knot core length Knot tails range Slipknot tails range Slipknot loops range N-end length C-end length Type
view details
+31 5-78 74 1-4 109-113 79-108 4 5 slipknot
Chain Sequence
NKVYLANAFSINMLTKFPTKVVIDKIDRLEFCENIDNEDIINSIGADSTIQLINSLCGTTFQKNRVEIKLEKEDKLYVVQISQRLEEGKILTLEEILKLYESGKVQFFEIIVD
Whole chain analysis
Subchain analysis 

Knotoid cutoff: 0.5


Knotoid matrix content: 1

Knot core range Knot core length Knot tails range Slipknot tails range Slipknot loops range N-end length C-end length Type
view details
3.1 4-78 75 1-3 108-113 79-107 3 6 slipknot
view details
2.1 6-84 79 1-3, 107-113 4-5, 85-106 3 7 slipknot
sequence length 113
structure length 113
publication title A viral anti-CRISPR subverts type III CRISPR immunity by rapid degradation of cyclic oligoadenylate
rcsb
molecule tags Dna
molecule keywords Uncharacterized protein
source organism Sulfolobus islandicus rod-shaped virus 1
total genus Genus: 29
ec nomenclature
pdb deposition date 2019-07-24
KnotProt deposition date 2019-11-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08960 DUF1874 Domain of unknown function (DUF1874)
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the KnotProt database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the KnotProt database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...

KnotProt | Interdisciplinary Laboratory of Biological Systems Modelling
Application loaded.