Knot core range | Knot core length | Knot tails range | Slipknot tails range | Slipknot loops range | N-end length | C-end length | Type | |||||
---|---|---|---|---|---|---|---|---|---|---|---|---|
view details | +31 | 5-78 | 74 | 1-4 | 109-113 | 79-108 | 4 | 5 | slipknot |
Chain Sequence |
NKVYLANAFSINMLTKFPTKVVIDKIDRLEFCENIDNEDIINSIGADSTIQLINSLCGTTFQKNRVEIKLEKEDKLYVVQISQRLEEGKILTLEEILKLYESGKVQFFEIIVD
|
Knotoid cutoff: 0.5
Knotoid matrix content: 1
Knot core range | Knot core length | Knot tails range | Slipknot tails range | Slipknot loops range | N-end length | C-end length | Type | |||||
---|---|---|---|---|---|---|---|---|---|---|---|---|
view details | 3.1 | 4-78 | 75 | 1-3 | 108-113 | 79-107 | 3 | 6 | slipknot | |||
view details | 2.1 | 6-84 | 79 | 1-3, 107-113 | 4-5, 85-106 | 3 | 7 | slipknot |
sequence length |
113
|
structure length |
113
|
publication title |
A viral anti-CRISPR subverts type III CRISPR immunity by rapid degradation of cyclic oligoadenylate
rcsb |
molecule tags |
Dna
|
molecule keywords |
Uncharacterized protein
|
source organism |
Sulfolobus islandicus rod-shaped virus 1
|
total genus |
Genus: 29
|
ec nomenclature | |
pdb deposition date | 2019-07-24 |
KnotProt deposition date | 2019-11-06 |
chain | Pfam Accession Code | Pfam Family Identifier | Pfam Description |
---|---|---|---|
A | PF08960 | DUF1874 | Domain of unknown function (DUF1874) |
#similar chains in the KnotProt database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unknotted ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...