| Knot core range | Knot core length | Knot tails range | Slipknot tails range | Slipknot loops range | N-end length | C-end length | Type | |||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| view details |
 |
+31 | 5-78 | 74 | 1-4 | 109-113 | 79-108 | 4 | 5 | slipknot |
Chain Sequence |
NKVYLANAFSINMLTKFPTKVVIDKIDRLEFCENIDNEDIINSIGADSTIQLINSLCGTTFQKNRVEIKLEKEDKLYVVQISQRLEEGKILTLEEILKLYESGKVQFFEIIVD
|
Knotoid cutoff: 0.5
Knotoid matrix content: 1
| Knot core range | Knot core length | Knot tails range | Slipknot tails range | Slipknot loops range | N-end length | C-end length | Type | |||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| view details |
 |
3.1 | 4-78 | 75 | 1-3 | 108-113 | 79-107 | 3 | 6 | slipknot | ||
| view details |
 |
2.1 | 6-84 | 79 | 1-3, 107-113 | 4-5, 85-106 | 3 | 7 | slipknot |
| sequence length |
113
|
| structure length |
113
|
| publication title |
A viral anti-CRISPR subverts type III CRISPR immunity by rapid degradation of cyclic oligoadenylate
rcsb |
| molecule tags |
Dna
|
| molecule keywords |
Uncharacterized protein
|
| source organism |
Sulfolobus islandicus rod-shaped virus 1
|
| total genus |
 Genus: 29
|
| ec nomenclature | |
| pdb deposition date | 2019-07-24 |
| KnotProt deposition date | 2019-11-06 |
| chain | Pfam Accession Code | Pfam Family Identifier | Pfam Description |
|---|---|---|---|
| A | PF08960 | DUF1874 | Domain of unknown function (DUF1874) |
Image from the rcsb pdb (www.rcsb.org)
#similar chains in the KnotProt database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unknotted ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...
