6SF2B

Ternary complex of human bone morphogenetic protein 9 (bmp9) growth factor domain, its prodomain and extracellular domain of activin receptor-like kinase 1 (alk1).
Cysteine knot
Loop Piercing
view details
356-c-360-b-428-c-426 327-b-393
Chain Sequence
SHCQKTSLRVNFEDIGWDSWIIAPKEYEAYECKGGCFFPLADDVTPTKHAIVQTLVHLKFPTKVGKACCVPTKLSPISVLYKDDMGVPTLKYHYEGMSVAECGCR
sequence length 105
structure length 105
publication title Molecular basis of ALK1-mediated signalling by BMP9/BMP10 and their prodomain-bound forms.
pubmed doi rcsb
molecule tags Cytokine
molecule keywords Serine/threonine-protein kinase receptor R3
source organism Homo sapiens
ec nomenclature
pdb deposition date 2019-07-31
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the KnotProt database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the KnotProt database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...

KnotProt | Interdisciplinary Laboratory of Biological Systems Modelling