| Loop | Piercing | ||||
|---|---|---|---|---|---|
| view details | 352-c-356-b-423-c-421 | 323-b-389 |
Chain Sequence |
NYCKRTPLYIDFKEIGWDSWIIAPPGYEAYECRGVCNYPLAEHLTPTKHAIIQALVHLKNSQKASKACCVPTKLEPISILYLDKGVVTYKFKYEGMAVSECGCR
|
| sequence length |
104
|
| structure length |
104
|
| publication title |
Molecular basis of ALK1-mediated signalling by BMP9/BMP10 and their prodomain-bound forms.
pubmed doi rcsb |
| molecule tags |
Cytokine
|
| molecule keywords |
Serine/threonine-protein kinase receptor R3
|
| source organism |
Homo sapiens
|
| ec nomenclature | |
| pdb deposition date | 2019-07-31 |
Image from the rcsb pdb (www.rcsb.org)
#similar chains in the KnotProt database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unknotted ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...