6SF3B

Bone morphogenetic protein 10 (bmp10) in complex with extracellular domain of activin receptor-like kinase 1 (alk1) at 2.3 angstrom
Cysteine knot
Loop Piercing
view details
352-c-356-b-423-c-421 323-b-389
Chain Sequence
NYCKRTPLYIDFKEIGWDSWIIAPPGYEAYECRGVCNYPLAEHLTPTKHAIIQALVHLKNSQKASKACCVPTKLEPISILYLDKGVVTYKFKYEGMAVSECGCR
sequence length 104
structure length 104
publication title Molecular basis of ALK1-mediated signalling by BMP9/BMP10 and their prodomain-bound forms.
pubmed doi rcsb
molecule tags Cytokine
molecule keywords Serine/threonine-protein kinase receptor R3
source organism Homo sapiens
ec nomenclature
pdb deposition date 2019-07-31
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the KnotProt database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the KnotProt database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...

KnotProt | Interdisciplinary Laboratory of Biological Systems Modelling