| Loop | Piercing | ||||
|---|---|---|---|---|---|
| view details | 37-c-55-b-107-c-92 | 23-b-81 |
Chain Sequence |
MRPPQFTRAQWFAIQHISLNPPRCTIAMRAINNYRWRCKPVNTFVHEPLVDVQNVCFQEKVTCKNGQGNCYRSRFRMHITDCRLTNGSRYPNCRYRTRPGRRHIIVACENRDPRDSPRYPYVPVHFDASV
|
| sequence length |
130
|
| structure length |
130
|
| publication title |
Structural and functional characterization of new family enzymes derivates from human RNase 1 and 3 with antimicrobial and ribonuclease activity
rcsb |
| molecule tags |
Hydrolase
|
| molecule keywords |
RNase 3/1 version3
|
| source organism |
Synthetic construct
|
| ec nomenclature | |
| pdb deposition date | 2019-09-08 |
Image from the rcsb pdb (www.rcsb.org)
#similar chains in the KnotProt database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unknotted ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...
